compare

Comparison List

mKOκ

a.k.a. mKusabira-Orange-kappa

mKOκ is a basic (constitutively fluorescent) orange fluorescent protein published in 2008, derived from Verrillofungia concinna. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Verrillofungia concinna 24.5 kDa -

FPbase ID: HMK8R

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
551 563 105,000 0.61 64.05 4.2    
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
50.0 0.19 (W/cm2) Laser Point Scanning Confocal Tsutsui et al. (2008)
A caution on interpretation of photostability measurements
Add photostability info

mKOκ Sequence

BLAST

mKOκ was derived from mKO with the following mutations: K48E/P69V/K184E/K187E/S191D/S195G/L209Q
amino acid numbers relative to KO. show relative to mKO

MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAEGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHRLVRKTEGNITEQVEDAVAHS

Excerpts

No excerpts have been added for mKOκ
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving membrane voltage measurements using FRET with new fluorescent proteins

Tsutsui H, Karasawa S, Okamura Y, Miyawaki A

(2008). Nature Methods, 5(8) , 683-685. doi: 10.1038/nmeth.1235. Article   Pubmed

Additional References

  1. Characterization of a spectrally diverse set of fluorescent proteins as FRET acceptors for mTurquoise2

    Mastop M, Bindels Ds, Shaner Nc, Postma M, Gadella Twj, Goedhart J

    (2017). Scientific Reports, 7(1) , 11999. doi: 10.1038/s41598-017-12212-x. Article   Pubmed

  2. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change