compare

Comparison List

miniSOG

a.k.a. mini Singlet Oxygen Generator

miniSOG is a basic (constitutively fluorescent) cyan fluorescent protein published in 2011, derived from Arabidopsis thaliana. It requires the cofactor flavin for fluorescence.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Arabidopsis thaliana 12.3 kDa Flavin

FPbase ID: ZZHSE

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
447 501 14,100 0.43 6.06      

Photostability

No photostability measurements available ... add one!

miniSOG Sequence

MEKSFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNGRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLLHLQPMRDQKGELQYFIGVQLDG

Excerpts

No excerpts have been added for miniSOG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change