compare

Comparison List

mGold

mGold is a basic (constitutively fluorescent) yellow fluorescent protein published in 2020, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: UNETX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 531 107,000 0.64 68.48 5.9    

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
95.8 20.0 (mW/mm2) LED Widefield Saccharomyces cerevisiae 24.0 Lee et al. (2020)
29.8 20.0 (mW/mm2) LED Widefield 24.0 Lee et al. (2020)
218.0 20.0 (mW/mm2) LED Widefield HEK239A 24.0 Lee et al. (2020)

mGold Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTSLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mGold
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Versatile phenotype-activated cell sorting

Lee J, Liu Z, Suzuki Ph, Ahrens Jf, Lai S, Lu X, Guan S, St-Pierre F

(2020). Science Advances, 6(43) , eabb7438. doi: 10.1126/sciadv.abb7438. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change