compare

Comparison List

mGinger2

mGinger2 is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Heteractis crispa. It is reported to be a somewhat slowly-maturing monomer with high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Heteractis crispa 24.8 kDa -

FPbase ID: GSP4M

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
578 631 36,000 0.04 1.44 6.5 78.0  

Photostability

No photostability measurements available ... add one!

mGinger2 Sequence

mGinger2 was derived from mGinger1 with the following mutations: K12R/E29V/K120E/H203R/Y212H
amino acid numbers relative to HcRed. show relative to mGinger1

MLLKENMHIRMYMEGTVNGHYFKCKGVGDGNPFAGTQSMRVHVTEGAPLPFAFDILAPCCEYGSKTFVRYPADIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVEVHGTNFPADGPVMKKETCGWEPSTESVYPENGVLRGRNHMALKVGDSHLHCHHSTTYRSKKAERALIMPPRHSTDYCLQITSRKDDEYFELHETSVARYSD
GenBank: MK040730

Excerpts

No excerpts have been added for mGinger2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Monomerization of far-red fluorescent proteins

Wannier Tm, Gillespie Sk, Hutchins N, Mcisaac Rs, Wu S-Y, Shen Y, Campbell Re, Brown Ks, Mayo Sl

(2018). Proceedings of the National Academy of Sciences, 115(48) , E11294-E11301. doi: 10.1073/pnas.1807449115. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change