compare

Comparison List

meleCFP

meleCFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2008, derived from Mycedium elephantotus.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Mycedium elephantotus 25.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
454 485 47,400 0.74 35.08      

Photostability

no photostability measurements available ... add one!

meleCFP Sequence

MSVIKTDMKIRLQMQGAVNGHPFVITGEGEGKPYEGKHTINLTVQDGGPLPFAFDILTTAFQYGNRVFTKYPKDIPDYFKQSFPAGYSWERCMTFEDGGLCTVSSHIKIEGDYFTYDIRFHGVNFPAGGPVMQKKTLRWEPSTENMYVRDGVLVGEVERTLLLEGNKHHRCNFRTTYKAKKEVVLPEYHFVDHRIEILGHDKDYNNVVVYENAVARQQASTLPSKAK
GenBank: ABB17955
UniProtKB: A8CLP7
IPG: 4901448

Excerpts

No excerpts have been added for meleCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change