compare

Comparison List

meffRFP

a.k.a. meffRed

meffRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Montipora efflorescens.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Montipora efflorescens 26.5 kDa -

FPbase ID: ND36H

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
560 576 99,600 0.56 55.78      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

meffRFP Sequence

BLAST
MALSKNGLTKNMTTKYRMEGCVDGHKFVITGDGIGDPFEGKQTSIDLCVVEGGPLPFSEDILSAVFDYGNRVFTKYPQDLVDYFKNSCPAGYTWQRSFLFEDGAVCTASADITVSVEENCFYHESKFHGVNFPADGPVMKKMTTNWEPSCEKITPIPNEGILKGDVTMFLLLKDGGRYRCQFDTVYKAKSDPKTIMMPDWHFIQHKLNREDRSDAKHQKWRLVENAIAYRSTLS
GenBank: ABB17952
UniProtKB: A8CLN4
IPG: 4901499

Excerpts

No excerpts have been added for meffRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and Evolution of Coral Fluorescent Proteins

Alieva No, Konzen Ka, Field Sf, Meleshkevitch Ea, Hunt Me, Beltran-Ramirez V, Miller Dj, Wiedenmann J, Salih A, Matz Mv

(2008). PLoS ONE, 3(7) , e2680. doi: 10.1371/journal.pone.0002680. Article   Pubmed

Additional References

  1. Engineering a palette of eukaryotic chromoproteins for bacterial synthetic biology

    Liljeruhm J, Funk Sk, Tietscher S, Edlund Ad, Jamal S, Wistrand-Yuen P, Dyrhage K, Gynnå A, Ivermark K, Lövgren J, Törnblom V, Virtanen A, Lundin Er, Wistrand-Yuen E, Forster Ac

    (2018). Journal of Biological Engineering, 12(1) , . doi: 10.1186/s13036-018-0100-0. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change