compare

Comparison List

meffRFP

meffRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Montipora efflorescens.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Montipora efflorescens 26.5 kDa -

FPbase ID: ND36H

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
560 576 99,600 0.56 55.78      

Photostability

No photostability measurements available ... add one!

meffRFP Sequence

MALSKNGLTKNMTTKYRMEGCVDGHKFVITGDGIGDPFEGKQTSIDLCVVEGGPLPFSEDILSAVFDYGNRVFTKYPQDLVDYFKNSCPAGYTWQRSFLFEDGAVCTASADITVSVEENCFYHESKFHGVNFPADGPVMKKMTTNWEPSCEKITPIPNEGILKGDVTMFLLLKDGGRYRCQFDTVYKAKSDPKTIMMPDWHFIQHKLNREDRSDAKHQKWRLVENAIAYRSTLS
GenBank: ABB17952
UniProtKB: A8CLN4
IPG: 4901499

Excerpts

No excerpts have been added for meffRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change