compare

Comparison List

meffCFP

meffCFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2008, derived from Montipora efflorescens.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Montipora efflorescens 26.0 kDa -

FPbase ID: 73TKS

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
467 492 88,600 0.55 48.73      

Photostability

No photostability measurements available ... add one!

meffCFP Sequence

MALSKQSLPSDMKLIYHMDGNVNGHSFVIKGEGEGKPYEGTHTIKLQVVEGSPLPFSADILSTVFQYGNRCFTKYPPNIVDYFKNSCSGGGYKFGRSFLYEDGAVCTASGDITLSADKKSFEHKSKFLGVNFPADGPVMKKETTNWEPSCEKMTPNGMTLIGDVTGFLLKEDGKRYKCQFHTFHDAKDKSKKMPMPDFHFVQHKIERKDLPGSMQTWRLTEHAAACKTCFTE
GenBank: ABB17954
UniProtKB: A8CLP2
IPG: 4901533

Excerpts

No excerpts have been added for meffCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change