compare

Comparison List

mECFP

similar: ECFP

mECFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Aequorea victoria.
+
mECFP Spectrum Fluorescent protein mECFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: MVN8T

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
433 475 33,000 0.41 13.53      

Photostability

No photostability measurements available ... add one!

mECFP Sequence

mECFP was derived from ECFP with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to ECFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mECFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change