compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mClover1.5

mClover1.5 is a fluorescent protein published in 2016, derived from Aequorea victoria. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.9 kDa	-

FPbase ID: DQDUN

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mClover1.5 Sequence

BLAST

mClover1.5 was derived from Clover1.5 with the following mutations: A207KA206K
amino acid numbers relative to Clover1.5avGFP. show relative to avGFP show relative to Clover1.5

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTFGYGVACFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHYVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for mClover1.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving brightness and photostability of green and red fluorescent proteins for live cell imaging and FRET reporting

Bajar Bt, Wang Es, Lam Aj, Kim Bb, Jacobs Cl, Howe Es, Davidson Mw, Lin Mz, Chu J

(2016). Scientific Reports, 6(1) , 20889. doi: 10.1038/srep20889. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for mClover1.5
Search RIKEN BRC for mClover1.5

Change history

Something missing or incorrect? Submit a change Submit a change