compare

Comparison List

mCherry_M10L

mCherry_M10L is a basic (constitutively fluorescent) red fluorescent protein published in 2022, derived from Discosoma sp..
+
Oligomerization Organism Molecular Weight Cofactor
? Discosoma sp. 26.7 kDa -

FPbase ID: XXLM6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
583 611          

Photostability

No photostability measurements available ... add one!

mCherry_M10L Sequence

mCherry_M10L was derived from mCherry with the following mutations: M6aL

MVSKGEEDNLAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mCherry_M10L
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

mCherry contains a fluorescent protein isoform that interferes with its reporter function

Fages-Lartaud M, Tietze L, Elie F, Lale R, Hohmann-Marriott Mf

(2022). Frontiers in Bioengineering and Biotechnology, 10, 892138. doi: 10.3389/fbioe.2022.892138. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change