compare

Comparison List

mCherry_I202Y

mCherry_I202Y is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from Discosoma sp..
+
Oligomerization Organism Molecular Weight Cofactor
? Discosoma sp. 26.8 kDa -

FPbase ID: P5PQK

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
592 620 0.02        

Photostability

No photostability measurements available ... add one!

mCherry_I202Y Sequence

mCherry_I202Y was derived from mCherry with the following mutations: I197Y
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNYKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mCherry_I202Y
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change