compare

Comparison List

mCerulean.B24

mCerulean.B24 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2011, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: 243P7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
433 473 43,000 0.52 22.36      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mCerulean.B24 Sequence

BLAST

mCerulean.B24 was derived from mCerulean.B2 with the following mutations: G147H
amino acid numbers relative to avGFP. show relative to mCerulean.B2

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAIHGNVYITADKQKNGIKANFGLRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCerulean.B24
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An Improved Cerulean Fluorescent Protein with Enhanced Brightness and Reduced Reversible Photoswitching

Markwardt Ml, Kremers G-J, Kraft Ca, Ray K, Cranfill Pjc, Wilson Ka, Day Rn, Wachter Rm, Davidson Mw, Rizzo Ma

(2011). PLoS ONE, 6(3) , e17896. doi: 10.1371/journal.pone.0017896. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change