compare

Comparison List

mCerulean.B2

mCerulean.B2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2011, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.7 kDa -

FPbase ID: 9ALF8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
432 471 39,000 0.5 19.5      

Photostability

No photostability measurements available ... add one!

mCerulean.B2 Sequence

mCerulean.B2 was derived from mCerulean.B with the following mutations: K166G/I167L
amino acid numbers relative to avGFP. show relative to mCerulean.B

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAIGGNVYITADKQKNGIKANFGLRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCerulean.B2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change