compare

Comparison List

mcCFP

similar: CFP

mcCFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2004, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Montastraea cavernosa 25.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
432 477 0.385       2.66

Photostability

no photostability measurements available ... add one!

mcCFP Sequence

MSVIKSVMKIKLRMDGIVNGHKFMITGEGEGKPFEGTHTIILKVKEGGPLPFAYDILTTAFQYGNRVFTKYPKDIPDYFKQSFPEGYSWERSMTFEDQGVCTVTSDIKLEGDCFFYEIRFYGVNFPSSGPVMQKKTLKWEPSTENMYVRDGVLLGDVSRTLLLEGDKHHRCNFRSTYGAKKGVVLPEYHFVDHRIEILSHDKDYNTVEVYENAVARPSMLPVKAK
GenBank: AAL17905
UniProtKB: Q95UA7
IPG: 516570

Excerpts

No excerpts have been added for mcCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change