compare

Comparison List

mcCFP

mcCFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2004, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Montastraea cavernosa 25.8 kDa -

FPbase ID: 6N98Z

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
432 477 0.385       2.66
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mcCFP Sequence

BLAST
MSVIKSVMKIKLRMDGIVNGHKFMITGEGEGKPFEGTHTIILKVKEGGPLPFAYDILTTAFQYGNRVFTKYPKDIPDYFKQSFPEGYSWERSMTFEDQGVCTVTSDIKLEGDCFFYEIRFYGVNFPSSGPVMQKKTLKWEPSTENMYVRDGVLLGDVSRTLLLEGDKHHRCNFRSTYGAKKGVVLPEYHFVDHRIEILSHDKDYNTVEVYENAVARPSMLPVKAK
GenBank: AAL17905
UniProtKB: Q95UA7
IPG: 516570

Excerpts

No excerpts have been added for mcCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Biophysical characterization of natural and mutant fluorescent proteins cloned from zooxanthellate corals

Sun Y, Castner Ew, Lawson Cl, Falkowski Pg

(2004). FEBS Letters, 570(1-3) , 175-183. doi: 10.1016/j.febslet.2004.06.043. Article   Pubmed

Additional References

  1. Spectral Diversity of Fluorescent Proteins from the Anthozoan Corynactis californica

    Schnitzler Ce, Keenan Rj, Mccord R, Matysik A, Christianson Lm, Haddock Shd

    (2008). Marine Biotechnology, 10(3) , 328-342. doi: 10.1007/s10126-007-9072-7. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change