compare

Comparison List

mcavRFP

mcavRFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2002, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 25.9 kDa -

FPbase ID: 4LQJE

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 580          

Photostability

No photostability measurements available ... add one!

mcavRFP Sequence

MSVIKSVMKIKLRMEGSVNGHNFVIVGEGEGKPYEGTQSMDLTVKEGAPLPFAYDIMTTVFHYGNRVFAKYPKHIPDYFKQMFPEEYSWERSMNFEGGGICTARNEITMEGDCFFNKVRFDGVNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLTGDINMALLLEGGGHYRCDFRTTYRAKKKGVKLPDYHFEDHSIEILRHDKEYTEVKLYEHAEAHSGLPRVAK
GenBank: AAK71336
UniProtKB: Q8T5F1
IPG: 7492

Excerpts

No excerpts have been added for mcavRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change