compare

Comparison List

mCarmine

mCarmine is a basic (constitutively fluorescent) far red fluorescent protein published in 2018, derived from Entacmaea quadricolor. It has moderate acid sensitivity.
+
mCarmine Spectrum Fluorescent protein mCarmine excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.7 kDa -

FPbase ID: LG377

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
603 675 83,000 0.07 5.81 5.58    

Photostability

No photostability measurements available ... add one!

mCarmine Sequence

mCarmine was derived from mNeptune684 with the following mutations: C61S/T103K/A104V/T105K/H157Y/P159T/I171Q/C172T/N173F
amino acid numbers relative to eqFP578. show relative to mNeptune684

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLKVKQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTETLYPADGGLRGYNTMALKLVGGGHLQTFLKTTYRSKKPAKNLKMPGVYFVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: MH062789

Excerpts

No excerpts have been added for mCarmine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Imaging-Based Screening Platform Assists Protein Engineering

Fabritius A, Ng D, Kist Am, Erdogan M, Portugues R, Griesbeck O

(2018). Cell Chemical Biology, , . doi: 10.1016/j.chembiol.2018.08.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change