compare

Comparison List

mNeptune684

mNeptune684 is a basic (constitutively fluorescent) far red fluorescent protein published in 2016, derived from Entacmaea quadricolor. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.5 kDa -

FPbase ID: Q8TQ6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
604 684 39,000 0.03 1.17 6.5    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mNeptune684 Sequence

BLAST

mNeptune684 was derived from mNeptune681 with the following mutations: Q159P
amino acid numbers relative to eqFP578. show relative to mNeptune681

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATCFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTETLYPADGGLRGHNPMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK

Excerpts

No excerpts have been added for mNeptune684
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Mutagenesis of mNeptune Red-Shifts Emission Spectrum to 681-685 nm

Li Zy, Zhang Zp, Bi Lj, Cui Zq, Deng Jy, Wang Db, Zhang X-E

(2016). PLOS ONE, 11(4) , e0148749. doi: 10.1371/journal.pone.0148749. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change