compare

Comparison List

mBaoJin

a.k.a. mBJ, mStayGold

mBaoJin is a basic (constitutively fluorescent) green fluorescent protein published in 2024, derived from Cytaeis uchidae. It is reported to be a very rapidly-maturing monomer with low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Cytaeis uchidae 26.6 kDa -

FPbase ID: 4XHVQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
500 508 128,000 0.93 119.04 4.37 7.6 3.1
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1350.0 12.8 (mW/mm2) Other Widefield Zhang et al. (2024)
A caution on interpretation of photostability measurements
Add photostability info

mBaoJin Sequence

BLAST

mBaoJin was derived from StayGold with the following mutations: *0_M1insMVSKGEEEN/S55T/H75R/E80G/Q140P/H141Q/C165Y/N171Y/T201A/*218KextGMDELYK

MVSKGEEENMASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTTFGYGMKYYTKYPSGLKNWFREVMPGGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVPQIPRDDGVECPVTLLYPLLSDKSKYVEAHQYTICKPLHNQPAPDVPYHWIRKQYTQSKDDAEERDHICQSETLEAHLKGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mBaoJin
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Bright and stable monomeric green fluorescent protein derived from StayGold

Zhang H, Lesnov Gd, Subach Om, Zhang W, Kuzmicheva Tp, Vlaskina Av, Samygina Vr, Chen L, Ye X, Nikolaeva Ay, Gabdulkhakov A, Papadaki S, Qin W, Borshchevskiy V, Perfilov Mm, Gavrikov As, Drobizhev M, Mishin As, Piatkevich Kd, Subach Fv

(2024). Nature Methods, , . doi: 10.1038/s41592-024-02203-y. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change