compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mBanana

mBanana is a basic (constitutively fluorescent) orange fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a somewhat slowly-maturing monomer with high acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Discosoma sp.	26.6 kDa	-

FPbase ID: 9GUD2

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
540	553	6,000	0.7	4.2	6.7	60.0

Edit States/Attributes

Photostability

t_1/2 (s)	Power	Light	Mode	In Cell	Fusion	˚C	Reference
1.4							Shaner et al. (2004)

A caution on interpretation of photostability measurements

Add photostability info

mBanana Sequence

BLAST

mBanana was derived from mTangerine with the following mutations: A2_D6delinsVSKGEENNMA/A77T/D78G/L83F/T108A/D174S/V177T/M182K/K194I/T195A/D196G/I197E/L199I/A225G/*226MextDELYKA2_D6delinsVSKGEENNMA/A77T/D78G/L83F/T108A/D174S/V177T/M182K/K194I/T195A/D196G/I197E/L199I/A225G/*224MextDELYK
amino acid numbers relative to mTangerineDsRed. show relative to DsRed show relative to mTangerine

MVSKGEENNMAVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFCYGSKAYVKHPTGIPDYFKLSFPEGFKWERVMNFEDGGVVTVAQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYSAETKTTYKAKKPVQLPGAYIAGEKIDITSHNEDYTIVELYERAEGRHSTGGMDELYK

GenBank: AAV52167

IPG: 3838242

Excerpts

No excerpts have been added for mBanana
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).