compare

Comparison List

mBanana

mBanana is a basic (constitutively fluorescent) orange fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a somewhat slowly-maturing monomer with high acid sensitivity.
+
mBanana Spectrum Fluorescent protein mBanana excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.6 kDa -

FPbase ID: 9GUD2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
540 553 6,000 0.7 4.2 6.7 60.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1.4   Shaner et al. (2004)

mBanana Sequence

mBanana was derived from mTangerine with the following mutations: A2_D6delinsVSKGEENNMA/A77T/D78G/L83F/T108A/D174S/V177T/M182K/K194I/T195A/D196G/I197E/L199I/A225G/*224MextDELYK
amino acid numbers relative to DsRed. show relative to mTangerine

MVSKGEENNMAVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFCYGSKAYVKHPTGIPDYFKLSFPEGFKWERVMNFEDGGVVTVAQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYSAETKTTYKAKKPVQLPGAYIAGEKIDITSHNEDYTIVELYERAEGRHSTGGMDELYK
GenBank: AAV52167
IPG: 3838242

Excerpts

No excerpts have been added for mBanana
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change