compare

Comparison List

M-Velour-537

M-Velour-537 is a basic (constitutively fluorescent) fluorescent protein published in 2022.
+
Oligomerization Organism Molecular Weight Cofactor
? <add one> 25.2 kDa -

FPbase ID: 5TSUE

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
537   72,000 0.001 0.07      

Photostability

No photostability measurements available ... add one!

M-Velour-537 Sequence

M-Velour-537 was derived from R-Velour with the following mutations: S155A

MALFAKPMNHKTEITGEFNGKCFKVVGHGSAPGGGDFRMHAYCESGTLPVSWCVLSPSIQYGFSMFTKYPNGITNFFQEAFPEGYTLDRVMTRENGGSVVSHHSYDLGKDGITAKVSVKGEGFDPNGPTMTKGYLKVLPFVCHLYPHGAGVRMTASVGMVKTDGSLDIFNVDSNYQPVGSRKVSVPKFHFVQHRIILMKDKSDTRDHIVMREIAVAQDPNEAQSAFRIA

Excerpts

No excerpts have been added for M-Velour-537
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change