compare

Comparison List

LSSmScarlet

LSSmScarlet is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2021, derived from synthetic construct. It is reported to be a somewhat slowly-maturing monomer with moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.3 kDa -

FPbase ID: POBTH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
470 598 30,200 0.42 12.68 5.8 61.0  

Photostability

No photostability measurements available ... add one!

LSSmScarlet Sequence

LSSmScarlet was derived from mScarlet with the following mutations: T74I/Y84H/K122E/W144L/S147D/F178V/K179R

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFIKHPADIPDYHKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYEVKLRGTNFPPDGPVMQKKTMGLEADTERLYPEDGVLKGDIKMALRLKDGGRYLADVRTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

Excerpts

No excerpts have been added for LSSmScarlet
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change