compare

Comparison List

LanYFP

LanYFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2013, derived from Branchiostoma lanceolatum. It has very low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Branchiostoma lanceolatum 24.7 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
513 524 150,000 0.95 142.5 3.5    

Photostability

no photostability measurements available ... add one!

LanYFP Sequence

MSLPATHELHIFGSFNGVDFDMVGRGTGNPNDGYEELNLKSTKGALQFSPWILVPQIGYGFHQYLPFPDGMSPFQAAMKDGSGYQVHRTMQFEDGASLTSNYRYTYEGSHIKGEFQVIGTGFPADGPVMTNSLTAADWCVTKMLYPNDKTIISTFDWTYTTGSGKRYQSTVRTNYTFAKPMAANILKNQPMFVFRKTELKHSKTELNFKEWQKAFTDVM
GenBank: ACA48232
UniProtKB: B1PNC0
IPG: 14640227

Structure

Deposited: ,
Chromophore:

Excerpts

Most newly cloned green and yellow fluorescent proteins are not subjected to additional engineering simply because of their lack of improved properties relative to existing proteins. Thus, we were intrigued that a yellow fluorescent protein from B. lanceolatum (LanYFP) exhibits an unusually high quantum yield (∼0.95) and extinction coefficient (∼150,000 M−1 cm−1), making it a very attractive candidate for additional development.

Shaner et al. (2013)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change