compare

Comparison List

KFP1

a.k.a. KFP-Red, asCP.A148G/K9T/K10E

KFP1 is a photoactivatable red fluorescent protein published in 2003, derived from Anemonia sulcata.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Anemonia sulcata 25.8 kDa -

FPbase ID: 5N1DD

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off 580 600 123,000 0.0001 0.01      
On 580 600 59,000 0.07 4.13      

Transitions

From To Switch λ
Off On 560

Photostability

No photostability measurements available ... add one!

KFP1 Sequence

MASLLTETMPFKTTIEGTVNGHCFKCIGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSCMYGSKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKVGRWEPGTEIVYEVDGVLRGQSLMALKCPGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEIMEEVEKGKCYKQYEAAVGRYCDAAPSKLGHN
GenBank: AAO43187
IPG: 605230

Excerpts

No excerpts have been added for KFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change