compare

Comparison List

KCY

KCY is a basic (constitutively fluorescent) cyan fluorescent protein published in 2009, derived from Verrillofungia concinna.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Verrillofungia concinna 24.7 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
455 488 38,700 0.85 32.9      

Photostability

no photostability measurements available ... add one!

KCY Sequence

MSVIKPEMKMKYFMDGSVNGHEFTVEGEGTGKPYEGKHKITLDVTKGGPLPFAFDLLSTVFSYGNRCLTKYPDDIPDYFKQCFPGGYSWERKFEFEDGGLAIAKAEISLKGNCFEHKSTIEGTFPDSSPIAQNKTLGWEPSTEKMTVRDGSMKGDDAAYLKLVGGGNHKCYFTTTYTAKKKIPNLPQSHFIGHRISSVVNGTKIGVMEDAIAHLYPFNGVPCQ

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for KCY
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change