compare

Comparison List

KCY-R1

KCY-R1 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2009, derived from Verrillofungia concinna.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Verrillofungia concinna 24.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
461 492 21,200 0.75 15.9      

Photostability

no photostability measurements available ... add one!

KCY-R1 Sequence

DPTMVSVIKPEMKMRYYMDGSVNGHEFTVEGEGTGRPYEGKQKITLDVTKGGPLPFAFDLLSTVFSYGNRALTKYPDDIPDYFKQCFPGGYSWERKFEFEDGGLAIAKAEISLKGNCFEHKSTIEGTFPDSSPIMQNKTLGWEPSTEKMTVRDGSMKGDDASYLKLVGGGNHKCYFTTTYTAKKKIPNLPGSHFIGHRISSVVEGTKIKVMEDAIAHLYPFNGS

Structure

Deposited: ,
Chromophore (SYG):

Excerpts

No excerpts have been added for KCY-R1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change