compare

Comparison List

KCY-R1-38H

KCY-R1-38H is a basic (constitutively fluorescent) cyan fluorescent protein published in 2009, derived from Verrillofungia concinna.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Verrillofungia concinna 24.9 kDa -

FPbase ID: JWC7O

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
459 489          

Photostability

No photostability measurements available ... add one!

KCY-R1-38H Sequence

DPTMVSVIKPEMKMRYYMDGSVNGHEFTVEGEGTGRPYEGKHKITLDVTKGGPLPFAFDLLSTVFSYGNRALTKYPDDIPDYFKQCFPGGYSWERKFEFEDGGLAIAKAEISLKGNCFEHKSTIEGTFPDSSPIMQNKTLGWEPSTEKMTVRDGSMKGDDASYLKLVGGGNHKCYFTTTYTAKKKIPNLPGSHFIGHRISSVVEGTKIKVMEDAIAHLYPFNGS

Excerpts

No excerpts have been added for KCY-R1-38H
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change