compare

Comparison List

htFuncLib_bleach.4

htFuncLib_bleach.4 is a basic (constitutively fluorescent) green fluorescent protein published in 2022, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 28.3 kDa -

FPbase ID: 97D3T

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
480 505 0.4   5.44   0.89

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
18.3 22.7 (mW) LED Widefield Weinstein et al. (2022)

htFuncLib_bleach.4 Sequence

MGSSHHHHHHVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVPCFTRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGCYKTRAEIKFEGDTLVNRIELHGIDFKEDGNILGHKLEYNMNSHNVYIMPDKQNNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDYHYLHTWSELSKDPNEKRDHMVLLEFVEAAGITLGMDELYK

Excerpts

No excerpts have been added for htFuncLib_bleach.4
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change