compare

Comparison List

htFuncLib_acid.1

htFuncLib_acid.1 is a basic (constitutively fluorescent) green fluorescent protein published in 2022, derived from Aequorea victoria. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 28.2 kDa -

FPbase ID: WO1AA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
486 508 0.71   3.88   1.08

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
23.4 22.7 (mW) LED Widefield Weinstein et al. (2022)

htFuncLib_acid.1 Sequence

MGSSHHHHHHVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGCYKTRAEVKFEGDTLVNRIELHGIDFKEDGNILGHKLEYNFNSHNVYIMPDKQNNGIKVNFKVRHNIEDGSVQLADLYQQNTPIGDGPVLLPDYHYLHTWSELSKDPNEKRDHMVLLEFIEAAGITLGMDELYK

Excerpts

No excerpts have been added for htFuncLib_acid.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change