compare

Comparison List

hcriCP

a.k.a. hcCP

hcriCP is a fluorescent protein published in 2001, derived from Heteractis crispa.
+
Oligomerization Organism Molecular Weight Cofactor
? Heteractis crispa 25.6 kDa -

FPbase ID: 8OX5S

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
578            

Photostability

No photostability measurements available ... add one!

hcriCP Sequence

MAGLLKESMRIKMYMEGTVNGHYFKCEGEGDGNPFTGTQSMRIHVTEGAPLPFAFDILAPCCEYGSRTFVHHTAEIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKNKSGGWEPCTEVVYPENGVLCGRNVMALKVGDRRLICHLYTSYRSKKAVRALTMPGFHFTDIRLQMPRKKKDEYFELYEASVARYSDLPEKAN
GenBank: AAL27538
UniProtKB: Q95W85
IPG: 1141167

Excerpts

No excerpts have been added for hcriCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Chromophore Environment Provides Clue to “Kindling Fluorescent Protein” Riddle

    Chudakov Dm, Feofanov Av, Mudrik Nn, Lukyanov S, Lukyanov Ka

    (2003). Journal of Biological Chemistry, 278(9) , 7215-7219. doi: 10.1074/jbc.m211988200. Article

  2. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change