compare

Comparison List

gtenCP

gtenCP is a fluorescent protein published in 2002, derived from Goniopora tenuidens.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Goniopora tenuidens 24.9 kDa -

FPbase ID: FTKQU

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

gtenCP Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVQGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPQSQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYNVKFSGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVKMPGYHYVDRKLDVTNHNIDYTSVEQCEISIARKPVVA
GenBank: AAL27542
UniProtKB: Q95P04
IPG: 496314

Excerpts

No excerpts have been added for gtenCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

  1. Spectral Diversity of Fluorescent Proteins from the Anthozoan Corynactis californica

    Schnitzler Ce, Keenan Rj, Mccord R, Matysik A, Christianson Lm, Haddock Shd

    (2008). Marine Biotechnology, 10(3) , 328-342. doi: 10.1007/s10126-007-9072-7. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change