compare

Comparison List

gtenCP

a.k.a. gtCP

gtenCP is a fluorescent protein published in 2001, derived from Goniopora tenuidens.
+
Oligomerization Organism Molecular Weight Cofactor
? Goniopora tenuidens 24.9 kDa -

FPbase ID: FTKQU

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
580            
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

gtenCP Sequence

BLAST
MSVIAKQMTYKVYMSGTVNGHYFEVQGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPQSQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYNVKFSGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVKMPGYHYVDRKLDVTNHNIDYTSVEQCEISIARKPVVA
GenBank: AAL27542
UniProtKB: Q95P04
IPG: 496314

Excerpts

No excerpts have been added for gtenCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

GFP-like chromoproteins as a source of far-red fluorescent proteins

Gurskaya Ng, Fradkov Af, Terskikh A, Matz Mv, Labas Ya, Martynov Vi, Yanushevich Yg, Lukyanov Ka, Lukyanov Sa

(2001). FEBS Letters, 507(1) , 16-20. doi: 10.1016/s0014-5793(01)02930-1. Article

Additional References

  1. Spectral Diversity of Fluorescent Proteins from the Anthozoan Corynactis californica

    Schnitzler Ce, Keenan Rj, Mccord R, Matysik A, Christianson Lm, Haddock Shd

    (2008). Marine Biotechnology, 10(3) , 328-342. doi: 10.1007/s10126-007-9072-7. Article   Pubmed

  2. A Purple-blue Chromoprotein from Goniopora tenuidens Belongs to the DsRed Subfamily of GFP-like Proteins

    Martynov Vi, Maksimov Bi, Martynova Ny, Pakhomov Aa, Gurskaya Ng, Lukyanov Sa

    (2003). Journal of Biological Chemistry, 278(47) , 46288-46292. doi: 10.1074/jbc.m306810200. Article

  3. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change