compare

Comparison List

gfasCP

a.k.a. gfasPurple

gfasCP is a fluorescent protein published in 2008, derived from Galaxea fascicularis.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Galaxea fascicularis 24.9 kDa -

FPbase ID: OXU4P

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
577   205,200          

Photostability

No photostability measurements available ... add one!

gfasCP Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPQSQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYHVKFSGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKSVVA
GenBank: ABB17967
UniProtKB: A8CLV6
IPG: 4901580

Structure

Deposited: ,
Chromophore (QYG):

Excerpts

No excerpts have been added for gfasCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Over the rainbow: structural characterization of the chromoproteins gfasPurple, amilCP, spisPink and eforRed

    Ahmed Fh, Caputo At, French Ng, Peat Ts, Whitfield J, Warden Ac, Newman J, Scott C

    (2022). Acta Crystallographica Section D Structural Biology, 78(5) , 599-612. doi: 10.1107/s2059798322002625. Article

  2. Overcoming chromoprotein limitations by engineering a red fluorescent protein

    Bao L, Menon Pnk, Liljeruhm J, Forster Ac

    (2020). Analytical Biochemistry, 611, 113936. doi: 10.1016/j.ab.2020.113936. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change