compare

Comparison List

eforCP

a.k.a. eforRed, eforRFP

eforCP is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Echinopora forskaliana.
+
eforCP Spectrum Fluorescent protein eforCP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Echinopora forskaliana 25.7 kDa -

FPbase ID: TDA9A

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
589 609 111,300 0.16 17.81      

Photostability

No photostability measurements available ... add one!

eforCP Sequence

MSVIKQVMKTKLHLEGTVNGHDFTIEGKGEGKPYEGLQHMKMTVTKGAPLPFSVHILTPSHMYGSKPFNKYPADIPDYHKQSFPEGMSWERSMIFEDGGVCTASNHSSINLQENCFIYDVKFHGVNLPPDGPVMQKTIAGWEPSVETLYVRDGMLKSDTAMVFKLKGGGHHRVDFKTTYKAKKPVKLPEFHFVEHRLELTKHDKDFTTWDQQEAAEGHFSPLPKALP
GenBank: ACD13196
UniProtKB: B6CTZ7
IPG: 14926077

Structure

Deposited: ,
Chromophore (MYG):

Excerpts

No excerpts have been added for eforCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Over the rainbow: structural characterization of the chromoproteins gfasPurple, amilCP, spisPink and eforRed

    Ahmed Fh, Caputo At, French Ng, Peat Ts, Whitfield J, Warden Ac, Newman J, Scott C

    (2022). Acta Crystallographica Section D Structural Biology, 78(5) , 599-612. doi: 10.1107/s2059798322002625. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change