compare

Comparison List

efasCFP

efasCFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2008, derived from Eusmilia fastigiata.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Eusmilia fastigiata 25.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
466 490 40,333 0.77 31.06      

Photostability

no photostability measurements available ... add one!

efasCFP Sequence

MSFSKQVLNDVTMTYFMEGSVNGHDFTIEGEGTGKPYEGHQRFNLRVTKGAPLPFAVDILSAAFAYGNRCFTKYPKEIPDFFKQSLPEDMSWERTMTFEDGGIVAISAHIRLIGNRFEHKSKFVGVNFPADGPVMQRKTLGWEPSSEKMTPRDGILKGYVPSFLVLQGGGNYRCDYDTSYRAMKPVEMPGGHFIQHRIVRRDIKKDSNGNTWQIQEDAFAHNSEVPDSA
GenBank: ABB17970
UniProtKB: A8CLW9
IPG: 4901480

Excerpts

No excerpts have been added for efasCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change