compare

Comparison List

E2-Red/Green

E2-Red/Green is a basic (constitutively fluorescent) red fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a somewhat slowly-maturing protein with low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Discosoma sp. 25.8 kDa -

FPbase ID: VB2NB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
560 585 53,800 0.67 36.05 4.5 72.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

E2-Red/Green Sequence

BLAST

E2-Red/Green was derived from DsRed-Express2 with the following mutations: Q42H/A44V/A217T/A219G

MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGEGEGKPYEGTHTVKLQVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGTFIYHVKFIGVNFPSDGPVMQKKTLGWEPSTERLYPRDGVLKGEIHKALKLKGGGHYLVEFKSIYMAKKPVKLPGYYYVDSKLDITSHNEDYTVVEQYERTEGRHHLFQ
GenBank: FJ498892

Excerpts

No excerpts have been added for E2-Red/Green
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Noncytotoxic orange and red/green derivatives of DsRed-Express2 for whole-cell labeling

Strack Rl, Bhattacharyya D, Glick Bs, Keenan Rj

(2009). BMC Biotechnology, 9(1) , 32. doi: 10.1186/1472-6750-9-32. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change