compare

Comparison List

E2-Crimson

E2-Crimson is a basic (constitutively fluorescent) far red fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a rapidly-maturing tetramer with low acid sensitivity.
+
E2-Crimson Spectrum Fluorescent protein E2-Crimson excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Discosoma sp. 25.7 kDa -

FPbase ID: VSU6B

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
611 646 126,000 0.23 28.98 4.5 24.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
26.0   Strack et al. (2009)
46.0 Widefield 25.0 Luker et al. (2015)

E2-Crimson Sequence

E2-Crimson was derived from DsRed-Express2 with the following mutations: E32V/Q66F/V71A/V73I/K83L/L85Q/F118L/L150N/I161N/K163M/V175C/Y193H/S197Y

MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGVGEGKPYEGTQTAKLQVTKGGPLPFAWDILSPQFFYGSKAYIKHPADIPDYLKQSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGTLIYHVKFIGVNFPSDGPVMQKKTLGWEPSTERNYPRDGVLKGENHMALKLKGGGHYLCEFKSIYMAKKPVKLPGYHYVDYKLDITSHNEDYTVVEQYERAEARHHLFQ
GenBank: AMO27221

Excerpts

No excerpts have been added for E2-Crimson
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change