compare

Comparison List

dVFP

similar: VFP

dVFP is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Cyphastrea microphthalma.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Cyphastrea microphthalma 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 503 107,000 1.0 107.0      

Photostability

no photostability measurements available ... add one!

dVFP Sequence

MNVIKPDMRIKLRMEGAVNGHKFVILGDGNGKPYEGTQTIDVTVKEGGPLPFAYDILTSAFQYGNRVFTKYPDDIADYFKQSFPVGYSWERSMTYEDGGICTVSSDIKMEGNSFIYEIRFHGLNFPSDGPVMQKKTVKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDFKSTYKAKRAVQLPDYHYIDHRIEILSHDKDYNKVKLCENAAARCSMLPSQAK

Excerpts

No excerpts have been added for dVFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change