compare

Comparison List

VFP

similar: mVFP

VFP is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Cyphastrea microphthalma.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Cyphastrea microphthalma 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 503 83,700 1.0 83.7      

Photostability

no photostability measurements available ... add one!

VFP Sequence

MNVIKPDMRIKLRMEGAVNGHKFVILGDGNGKPYEGTQTIDVTVKEGGPLPFAYDILTSAFQYGNRVFTKYPDDIADYFKQSFPVGYSWERSMTYEDGGICTVSSDIKMEGNSFIYEIRFHGLNFPSDGPVMQKKTVKWEPSTEKMYVRDGVLKGDVNMTLLLEGGGHYRCDFKSTYKAKRAVQLPDYHYIDHRIEILSHDKDYNKVKLCENAAARCSMLPSQAK
GenBank: CBI12485
UniProtKB: D1J6P8
IPG: 19026071

Excerpts

No excerpts have been added for VFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change