compare

Comparison List

VFP

similar: mVFP

VFP is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Cyphastrea microphthalma.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Cyphastrea microphthalma 25.6 kDa -

FPbase ID: P3DVP

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 503 83,700 1.0 83.7      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

VFP Sequence

BLAST
MNVIKPDMRIKLRMEGAVNGHKFVILGDGNGKPYEGTQTIDVTVKEGGPLPFAYDILTSAFQYGNRVFTKYPDDIADYFKQSFPVGYSWERSMTYEDGGICTVSSDIKMEGNSFIYEIRFHGLNFPSDGPVMQKKTVKWEPSTEKMYVRDGVLKGDVNMTLLLEGGGHYRCDFKSTYKAKRAVQLPDYHYIDHRIEILSHDKDYNKVKLCENAAARCSMLPSQAK
GenBank: CBI12485
UniProtKB: D1J6P8
IPG: 19026071

Excerpts

No excerpts have been added for VFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A new bright green-emitting fluorescent protein - engineered monomeric and dimeric forms

Ilagan Rp, Rhoades E, Gruber Df, Kao H-T, Pieribone Va, Regan L

(2010). FEBS Journal, 277(8) , 1967-1978. doi: 10.1111/j.1742-4658.2010.07618.x. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change