compare

Comparison List

DsRed-Max

DsRed-Max is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Discosoma sp.. It is reported to be a somewhat slowly-maturing tetramer.
+
DsRed-Max Spectrum Fluorescent protein DsRed-Max excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Discosoma sp. 25.7 kDa -

FPbase ID: UVJD2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
560 589 48,000 0.41 19.68   72.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
9.0   Strack et al. (2008)

DsRed-Max Sequence

DsRed-Max was derived from DsRed-Express2 with the following mutations: Q66M/V73T/V175C/A217T

MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGEGEGKPYEGTQTAKLQVTKGGPLPFAWDILSPQFMYGSKVYTKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGTFIYHVKFIGVNFPSDGPVMQKKTLGWEPSTERLYPRDGVLKGEIHKALKLKGGGHYLCEFKSIYMAKKPVKLPGYYYVDSKLDITSHNEDYTVVEQYERTEARHHLFQ
GenBank: ACJ05620

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for DsRed-Max
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change