compare

Comparison List

dsFP483

a.k.a. dstrCyFP

dsFP483 is a basic (constitutively fluorescent) cyan fluorescent protein published in 1999, derived from Discosoma striata.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Discosoma striata 26.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
443 483 23,900 0.46 10.99      

Photostability

no photostability measurements available ... add one!

dsFP483 Sequence

MSCSKSVIKEEMLIDLHLEGTFNGHYFEIKGKGKGQPNEGTNTVTLEVTKGGPLPFGWHILCPQFQYGNKAFVHHPDNIHDYLKLSFPEGYTWERSMHFEDGGLCCITNDISLTGNCFYYDIKFTGLNFPPNGPVVQKKTTGWEPSTERLYPRDGVLIGDIHHALTVEGGGHYACDIKTVYRAKKAALKMPGYHYVDTKLVIWNNDKEFMKVEEHEIAVARHHPFYEPKKDK
GenBank: AAF03370
UniProtKB: Q9U6Y7
IPG: 200279

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for dsFP483
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change