compare

Comparison List

show comparison

Javascript is disabled! Many pages and features of FPbase will not work properly

dsFP483

a.k.a. dstrCyFP

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Nov 2, 2018 11:36:52. Or view the full change history

dsFP483 is a basic (constitutively fluorescent) cyan fluorescent protein published in 1999, derived from Discosoma striata.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Tetramer	Discosoma striata	26.4 kDa	-

FPbase ID: YG5WM

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
443	483	23,900	0.46	10.99

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

dsFP483 Sequence

MSCSKSVIKEEMLIDLHLEGTFNGHYFEIKGKGKGQPNEGTNTVTLEVTKGGPLPFGWHILCPQFQYGNKAFVHHPDNIHDYLKLSFPEGYTWERSMHFEDGGLCCITNDISLTGNCFYYDIKFTGLNFPPNGPVVQKKTTGWEPSTERLYPRDGVLIGDIHHALTVEGGGHYACDIKTVYRAKKAALKMPGYHYVDTKLVIWNNDKEFMKVEEHEIAVARHHPFYEPKKDK

GenBank: AAF03370

UniProtKB: Q9U6Y7

IPG: 200279

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for dsFP483
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Erratum: Fluorescent proteins from nonbioluminescent Anthozoa species

Matz Mv, Fradkov Af, Labas Ya, Savitsky Ap, Zaraisky Ag, Markelov Ml, Lukyanov Sa

(1999). Nature Biotechnology, 17(10) , 969-973. doi: 10.1038/13657. Article Pubmed

Additional References

Blue-Shifted Green Fluorescent Protein Homologues Are Brighter than Enhanced Green Fluorescent Protein under Two-Photon Excitation

Molina Rs, Tran Tm, Campbell Re, Lambert Gg, Salih A, Shaner Nc, Hughes Te, Drobizhev M

(2017). The Journal of Physical Chemistry Letters, 8(12) , 2548-2554. doi: 10.1021/acs.jpclett.7b00960. Article Pubmed
Directed evolution of a monomeric, bright and photostable version ofClavulariacyan fluorescent protein: structural characterization and applications in fluorescence imaging

Ai H-, Henderson Jn, Remington Sj, Campbell Re

(2006). Biochemical Journal, 400(3) , 531-540. doi: 10.1042/bj20060874. Article Pubmed

External Resources

Search Addgene for dsFP483
Search RIKEN BRC for dsFP483

Something missing or incorrect? Submit a change Submit a change