compare

Comparison List

Dronpa-C62S

Dronpa-C62S is a fluorescent protein published in 2007, derived from Echinophyllia sp. SC22. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.5 kDa -

FPbase ID: NW2SG

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Dronpa-C62S Sequence

Dronpa-C62S was derived from Dronpa with the following mutations: C62S

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFSYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Dronpa-C62S
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Structural characterization of the photoswitchable fluorescent protein Dronpa-C62S

Nam K-H, Kwon Oy, Sugiyama K, Lee W-H, Kim Yk, Song Hk, Kim Ee, Park S-Y, Jeon H, Hwang Ky

(2007). Biochemical and Biophysical Research Communications, 354(4) , 962-967. doi: 10.1016/j.bbrc.2007.01.086. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change