compare

Comparison List

dPapaya0.1

dPapaya0.1 is a fluorescent protein published in 2013, derived from Zoanthus sp.. It is reported to be a dimer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Zoanthus sp. 27.6 kDa -

FPbase ID: ZRNCZ

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

dPapaya0.1 Sequence

dPapaya0.1 was derived from tPapaya0.01 with the following mutations: I106R/V115E
amino acid numbers relative to zFP538. show relative to tPapaya0.01

MVSKGEEHSKHGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGFKYGDRIFTEYPQDIVDYFKNSCPAGYTWGRSFLFEDGAVCRCNVDITVSEKENCIYHKSIFNGVNFPADGPVMKKMTTNWEASCEKIMPVPKQGILKGDVSMYLLLKDGGRYRCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAFPSALAGMDELYK

Excerpts

No excerpts have been added for dPapaya0.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An Engineered Monomeric Zoanthus sp. Yellow Fluorescent Protein

Hoi H, Howe Es, Ding Y, Zhang W, Baird Ma, Sell Br, Allen Jr, Davidson Mw, Campbell Re

(2013). Chemistry & Biology, 20(10) , 1296-1304. doi: 10.1016/j.chembiol.2013.08.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change