compare

Comparison List

dCyOFP2s

dCyOFP2s is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2021, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing dimer with moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 2DGCJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
510 592 36,000 0.69 24.84 5.29 24.0  

Photostability

No photostability measurements available ... add one!

dCyOFP2s Sequence

dCyOFP2s was derived from CyOFP1 with the following mutations: N173S
amino acid numbers relative to eqFP578. show relative to CyOFP1

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGKQTNRIKVVEGGPLPFAFDILATHFMYGSKVFIKYPADLPDYFKQSFPEGFTWERVMVFEDGGVLTATQDTSLQDGELIYNVKVRGVNFPANGPVMQKKTLGWEPSTETMYPADGGLEGRCDKALKLVGGGHLHVSFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQYEHAVARYSNLGGGMDELYK

Excerpts

No excerpts have been added for dCyOFP2s
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change