compare

Comparison List

cpCitrine

cpCitrine is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2001, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 27.3 kDa -

FPbase ID: 9PBZV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
506 524 20,000 0.1 2.0      

Photostability

No photostability measurements available ... add one!

cpCitrine Sequence

DPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFILTTGKLPVPWPTLVTTFGYGLMVFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for cpCitrine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Reducing the Environmental Sensitivity of Yellow Fluorescent Protein

Griesbeck O, Baird Gs, Campbell Re, Zacharias Da, Tsien Ry

(2001). Journal of Biological Chemistry, 276(31) , 29188-29194. doi: 10.1074/jbc.m102815200. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change