compare

Comparison List

cp-mKate

a.k.a. Circular Permutated mKate

cp-mKate is a basic (constitutively fluorescent) red fluorescent protein published in 2011, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.2 kDa -

FPbase ID: 2EM4B

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 620 0.33        
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

cp-mKate Sequence

BLAST
GHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHAGGTGGSMSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDMALKLV

Structure

Deposited: ,
Chromophore (MYG):

Excerpts

No excerpts have been added for cp-mKate
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Circular Permutation of Red Fluorescent Proteins

Shui B, Wang Q, Lee F, Byrnes Lj, Chudakov Dm, Lukyanov Sa, Sondermann H, Kotlikoff Mi

(2011). PLoS ONE, 6(5) , e20505. doi: 10.1371/journal.pone.0020505. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change