compare

Comparison List

cgfTagRFP

cgfTagRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Entacmaea quadricolor. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.1 kDa -

FPbase ID: G9U12

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
555 584 86,000 0.42 36.12 2.9    

Photostability

No photostability measurements available ... add one!

cgfTagRFP Sequence

cgfTagRFP was derived from TagRFP with the following mutations: C26A/C114M/C172V/C222S

MSELIKENMHMKLYMEGTVNNHHFKATSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGMLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALKLVGGGHLIVNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYSDLPSKLGHK

Excerpts

No excerpts have been added for cgfTagRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change