compare

Comparison List

cgfmKate2

cgfmKate2 is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Entacmaea quadricolor. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.0 kDa -

FPbase ID: 2D7XF

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
584 628 55,000 0.47 25.85 4.6    

Photostability

No photostability measurements available ... add one!

cgfmKate2 Sequence

cgfmKate2 was derived from mKate2 with the following mutations: C26A/C114M/C172A/C222S
amino acid numbers relative to eqFP578. show relative to mKate2

MVSELIKENMHMKLYMEGTVNNHHFKATSEGEGKPYEGTQTMRIKAVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGMLIYNVKIRGVNFPSNGPVMQKKTLGWEASTETLYPADGGLEGRADMALKLVGGGHLIANLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYSDLPSKLGHR

Excerpts

No excerpts have been added for cgfmKate2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change