compare

Comparison List

ccalYFP1

ccalYFP1 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2008, derived from Corynactis californica.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Corynactis californica 25.0 kDa -

FPbase ID: WVV8W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 523 142,000 0.75 106.5      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

ccalYFP1 Sequence

BLAST
MSHSKQVITQEMKMVYHMDGCVNGHSFTIEGEGTGKPYEGNQTLKLRVTKGGPLPFAFDILTATFCYGNRCFCEYPEDMPDYYKQSFPEGYSFERTMMFEDGACCTTSVHLSLTKNCFVHNSTFHGVNFPANGPVMQKKTLNWEPSSEKITPFEGNLKGDVTMFLKLEGGQQHRCQFQTTYKAHKAVKMPPNHIIEHRLVRSQDGDAVQLKEHAVAKCFTA
GenBank: AAZ67343
UniProtKB: Q2VTM8
IPG: 4620335

Excerpts

No excerpts have been added for ccalYFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Spectral Diversity of Fluorescent Proteins from the Anthozoan Corynactis californica

Schnitzler Ce, Keenan Rj, Mccord R, Matysik A, Christianson Lm, Haddock Shd

(2008). Marine Biotechnology, 10(3) , 328-342. doi: 10.1007/s10126-007-9072-7. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change