compare

Comparison List

ccalRFP1

ccalRFP1 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Corynactis californica.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Corynactis californica 24.8 kDa -

FPbase ID: T44E8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
568 598 92,000 0.59 54.28      

Photostability

No photostability measurements available ... add one!

ccalRFP1 Sequence

MSLSKQVLPRDVKMRYHMDGCVNGHQFIIEGEGTGKPYEGKKILELRVTKGGPLPFAFDILSSVFTYGNRCFCEYPEDMPDYFKQSLPEGHSWERTLMFEDGGCGTASAHISLDKNCFVHKSTFHGVNFPANGPVMQKKTLNWEPSSELITAGDGILKGDVTMFLMLEGGHRLKCQFTTSYKAKKAVKMPPNHIIEHRLVRKEVADAVQIQEHAVAKHFIV
GenBank: AAZ67342
UniProtKB: Q2VTM9
IPG: 4620339

Excerpts

No excerpts have been added for ccalRFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change