compare

Comparison List

ccalGFP3

ccalGFP3 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2008, derived from Corynactis californica.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Corynactis californica 24.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
505 517 144,000 0.48 69.12      

Photostability

no photostability measurements available ... add one!

ccalGFP3 Sequence

MSLSKQVVKQDMNMTYHMDGCVNGHSFTIEGEGRGNPFKGQQTLKLRVTKGGPLPFAFDILSATFTYGNRCFCDYPEDMPDYFKQSLPEGYSWERTMMYEDGGCGTASAHISLNKTGFVHKSTFHGVNFPANGPVMQRKTVNWEPSTEKITACDGTLKGDVTMFLLLGGGYQQKCQFQTTYRTDKTVKMPPNHIIEHRLVRSEDGDAVQIQEHAVAKYFTV
GenBank: ABI58282
UniProtKB: Q09HR5
IPG: 6067037

Excerpts

No excerpts have been added for ccalGFP3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change